whitemagickalchemyblog.com
Free website and domain report on whitemagickalchemyblog.com
Last Updated: 19th May, 2020 Update Now
Overview
Snoop Summary for whitemagickalchemyblog.com
This is a free and comprehensive report about whitemagickalchemyblog.com. The domain whitemagickalchemyblog.com is currently hosted on a server located in United States with the IP address 192.254.234.191, where USD is the local currency and the local language is English. This report was last updated 19th May, 2020.
About whitemagickalchemyblog.com
| Site Preview: | |
| Title: | WhiteMagickAlchemyBlog - Witchcraft Supplies | Pagan Supplies |
| Description: | Witchcraft Supplies | Pagan Supplies |
| Keywords and Tags: | |
| Related Terms: | boatbuilding supplies, cupcake supplies, disco supplies, equestrian supplies, equine supplies, knitting supplies, lotion supplies, sugarcraft supplies, toiletry supplies, transvestite supplies |
| Fav Icon: | |
| Age: | Over 12 years old |
| Domain Created: | 18th September, 2012 |
| Domain Updated: | 18th September, 2019 |
| Domain Expires: | 18th September, 2020 |
Review
Snoop Score
Valuation
Popularity
Rank, Reach and Authority
| Alexa Rank: | |
| Alexa Reach: | |
| SEMrush Rank (US): | |
| SEMrush Authority Score: | |
| Moz Domain Authority: | |
| Moz Page Authority: |
Organic vs Paid (Google Ads)
Traffic
Visitors
| Daily Visitors: | |
| Monthly Visitors: | |
| Yearly Visitors: |
Note: All visitors figures are estimates.
Visitors By Country
Revenue
Revenue
| Daily Revenue: | |
| Monthly Revenue: | |
| Yearly Revenue: |
Note: All revenue figures are estimates.
Revenue By Country
SEO
Backlinks Analysis (SEMrush)
Top New Follow Links
Top Ranking Keywords (US)
Domain Analysis
| Value | Length | |
|---|---|---|
| Domain: | whitemagickalchemyblog.com | 26 |
| Domain Name: | whitemagickalchemyblog | 22 |
| Extension (TLD): | com | 3 |
| Expiry Check: | |
Page Speed Analysis
| Average Load Time: | |
| Load Time Comparison: |
PageSpeed Insights
Hosting
Server Location
| Server IP Address: | 192.254.234.191 |
| Continent: | North America |
| Country: | United States  |
| Region: | |
| City: | |
| Longitude: | -97.822 |
| Latitude: | 37.751 |
| Currencies: | USD USN USS |
| Languages: | English |
Web Hosting Provider
Registration
Domain Registrant
| Private Registration: | No |
| Name: | |
| Organization: |
| Country: | |
| City: | |
| State: | |
| Post Code: | |
| Email: | |
| Phone: |
Note: Registration information is derived from various sources and may be inaccurate.
Domain Registrar
| Name | IP Address |
|---|---|
| GoDaddy.com, LLC | 184.25.36.36 |
Security
Visitor Safety
| Mature Content: |  Not Likely |
| McAfee WebAdvisor Rating: | |
| WOT Rating: | |
| WOT Trustworthiness: | |
| WOT Child Safety: |
Note: Safety information is not guaranteed.
SSL/TLS Certificate
| Issued To: | mail.whitemagickalchemyblog.com |
| Issued By: | Let's Encrypt Authority X3 |
| Valid From: | 8th May, 2020 |
| Valid To: | 6th August, 2020 |
| Subject: | CN = mail.whitemagickalchemyblog.com |
| Hash: | 59423af0 |
| Issuer: | CN = Let's Encrypt Authority X3 O = Let's Encrypt S = US |
| Version: | 2 |
| Serial Number: | 0x04A2F37AC78DF5DF6A56C00DCD34BDE6C6C1 |
| Serial Number (Hex): | 04A2F37AC78DF5DF6A56C00DCD34BDE6C6C1 |
| Valid From: | 8th May, 2024 |
| Valid To: | 6th August, 2024 |
| Signature Algorithm (Short Name): | RSA-SHA256 |
| Signature Algorithm (Long Name): | sha256WithRSAEncryption |
| Authority Key Identifier: | keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1 |
| Extended Key Usage: | TLS Web Server Authentication, TLS Web Client Authentication |
| Certificate Policies: | Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org |
| Authority Information Access: | OCSP - URI:http://ocsp.int-x3.letsencrypt.org CA Issuers - URI:http://cert.int-x3.letsencrypt.org/ |
| SCT List: | Signed Certificate Timestamp: Version : v1 (0x0) Log ID : B2:1E:05:CC:8B:A2:CD:8A:20:4E:87:66:F9:2B:B9:8A: 25:20:67:6B:DA:FA:70:E7:B2:49:53:2D:EF:8B:90:5E Timestamp : May 8 11:36:25.513 2020 GMT Extensions: none Signature : ecdsa-with-SHA256 30:45:02:21:00:94:DC:49:F3:14:E7:63:FF:E7:3A:19: A1:B1:2C:E8:5B:7C:99:DC:E9:4B:E7:12:12:F3:59:3E: 9E:BA:CB:25:98:02:20:75:37:1C:37:7C:D4:F2:5D:CC: CF:85:ED:0D:28:34:B9:27:91:B2:DE:3E:E9:70:F5:D3: 47:56:60:E3:05:36:83 Signed Certificate Timestamp: Version : v1 (0x0) Log ID : 6F:53:76:AC:31:F0:31:19:D8:99:00:A4:51:15:FF:77: 15:1C:11:D9:02:C1:00:29:06:8D:B2:08:9A:37:D9:13 Timestamp : May 8 11:36:25.560 2020 GMT Extensions: none Signature : ecdsa-with-SHA256 30:46:02:21:00:90:6A:DD:83:B8:34:A9:F7:81:BD:9C: AA:4E:A1:FF:EC:A4:06:04:A8:AC:D1:81:D6:B0:CC:DC: D0:81:D9:CF:95:02:21:00:91:E2:64:78:53:B6:63:37: 9F:22:AF:55:BC:7F:E5:AB:8B:FB:53:F3:42:D6:92:0F: C5:B9:57:09:B8:CB:3A:DF |
| Key Usage: | Digital Signature, Key Encipherment |
| Basic Constraints: | CA:FALSE |
| Subject Alternative Name: | DNS:cpanel.whitemagickalchemyblog.com DNS:cpcalendars.whitemagickalchemyblog.com DNS:cpcontacts.whitemagickalchemyblog.com DNS:mail.whitemagickalchemyblog.com DNS:webdisk.whitemagickalchemyblog.com DNS:webmail.whitemagickalchemyblog.com DNS:whitemagickalchemyblog.com DNS:whitemagickcrystals.whitemagickalchemyblog.com DNS:www.whitemagickalchemyblog.com DNS:www.whitemagickcrystals.whitemagickalchemyblog.com DNS:autodiscover.whitemagickalchemyblog.com |
Technical
DNS Lookup
A Records
| Host | IP Address | Class | TTL |
|---|---|---|---|
| whitemagickalchemyblog.com. | 192.254.234.191 | IN | 14399 |
NS Records
| Host | Nameserver | Class | TTL |
|---|---|---|---|
| whitemagickalchemyblog.com. | ns831.hostgator.com. | IN | 21599 |
| whitemagickalchemyblog.com. | ns832.hostgator.com. | IN | 21599 |
MX Records
| Priority | Host | Server | Class | TTL |
|---|---|---|---|---|
| 0 | whitemagickalchemyblog.com. | whitemagickalchemyblog.com. | IN | 14399 |
SOA Records
| Domain Name | Primary NS | Responsible Email | TTL |
|---|---|---|---|
| whitemagickalchemyblog.com. | ns6479.hostgator.com. | dnsadmin.gator3240.hostgator.com. | 21599 |
TXT Records
| Host | Value | Class | TTL |
|---|---|---|---|
| whitemagickalchemyblog.com. | v=spf1 | IN | 14399 |
HTTP Response Headers
| HTTP-Code: | HTTP/1.1 200 OK |
| Date: | 19th May, 2020 |
| Server: | Apache |
| Content-Type: | text/html; charset=UTF-8 |
| Link: | <http://whitemagickalchemyblog.com/wp-json/>; rel="https://api.w.org/" |
| Upgrade: | h2,h2c |
| Connection: | Upgrade |
Whois Lookup
| Created: | 18th September, 2012 |
| Changed: | 18th September, 2019 |
| Expires: | 18th September, 2020 |
| Registrar: | GoDaddy.com, LLC |
| Status: | clientTransferProhibited clientUpdateProhibited clientRenewProhibited clientDeleteProhibited |
| Nameservers: | ns831.hostgator.com ns832.hostgator.com |
| Owner Organization: | Purple Sun Candle Co, Inc. |
| Owner State: | California |
| Owner Country: | US |
| Owner Email: | Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=WHITEMAGICKALCHEMYBLOG.COM |
| Admin Email: | Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=WHITEMAGICKALCHEMYBLOG.COM |
| Tech Email: | Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=WHITEMAGICKALCHEMYBLOG.COM |
| Full Whois: | Domain Name: WHITEMAGICKALCHEMYBLOG.COM
Registry Domain ID: 1745727483_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2019-09-18T14:45:15Z Creation Date: 2012-09-18T00:12:55Z Registrar Registration Expiration Date: 2020-09-18T00:12:55Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited Registrant Organization: Purple Sun Candle Co, Inc. Registrant State/Province: California Registrant Country: US Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=WHITEMAGICKALCHEMYBLOG.COM Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=WHITEMAGICKALCHEMYBLOG.COM Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=WHITEMAGICKALCHEMYBLOG.COM Name Server: NS831.HOSTGATOR.COM Name Server: NS832.HOSTGATOR.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2020-05-19T04:00:00Z <<< For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en Notes: IMPORTANT: Port43 will provide the ICANN-required minimum data set per ICANN Temporary Specification, adopted 17 May 2018. Visit https://whois.godaddy.com to look up contact data for domains not covered by GDPR policy. The data contained in GoDaddy.com, LLC's WhoIs database, while believed by the company to be reliable, is provided "as is" with no guarantee or warranties regarding its accuracy. This information is provided for the sole purpose of assisting you in obtaining information about domain name registration records. Any use of this data for any other purpose is expressly forbidden without the prior written permission of GoDaddy.com, LLC. By submitting an inquiry, you agree to these terms of usage and limitations of warranty. In particular, you agree not to use this data to allow, enable, or otherwise make possible, dissemination or collection of this data, in part or in its entirety, for any purpose, such as the transmission of unsolicited advertising and and solicitations of any kind, including spam. You further agree not to use this data to enable high volume, automated or robotic electronic processes designed to collect or compile this data for any purpose, including mining this data for your own personal or commercial purposes. Please note: the registrant of the domain name is specified in the "registrant" section. In most cases, GoDaddy.com, LLC is not the registrant of domain names listed in this database. |
Nameservers
| Name | IP Address |
|---|---|
| ns831.hostgator.com | 192.254.234.180 |
| ns832.hostgator.com | 192.254.234.181 |
Love W3 Snoop?
Share This